PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29780.m001324
Common NameLOC8283269, RCOM_0774170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family G2-like
Protein Properties Length: 408aa    MW: 45282.7 Da    PI: 7.9516
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29780.m001324genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.11.7e-32263318156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+peLH+rFv+a++qLGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  29780.m001324 263 KQRRCWSPELHRRFVSALQQLGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 318
                    79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.3E-18260321IPR009057Homeodomain-like
PROSITE profilePS5129414.011260320IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-29261322IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-26263318IPR006447Myb domain, plants
PfamPF002499.7E-8265316IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MGSLPPELSL DFRPSYVPKT ISDILNEVSL IRNVSDKVSK LDGFVNGLQE EMKKIDAFKR  60
ELPLCMLLLN DAILFLKSEL MQCAALDHQP ILEEFMPLKK HSDRDDDDDG DQDGPIKKEK  120
DTKDKKNWMS SVQLWNTDDH PSTHNILETK QNLQLESKTT KKGNYQYAND DTFSACKSRS  180
AARAFMPFKT YPDLSRKEDK HSTQELPVPG LSLLTPGIKN LREESTSTGS RVSCSRAVSS  240
STPNPQSNLR NGPQSPQQQT ARKQRRCWSP ELHRRFVSAL QQLGGSQAAT PKQIRELMQV  300
DGLTNDEVKS HLQKYRLHTR RMPSATAAAT NHSLVVLGGG LRMSQDQYGD DSKAAGSQSG  360
SPQGPLQLAG NTGATSTTGG DSMEDDEDAK SEGYSWKSQI HRSGKVHV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002521841.10.0PREDICTED: uncharacterized protein LOC8283269
TrEMBLB9S7720.0B9S772_RICCO; Putative uncharacterized protein
STRINGPOPTR_0004s15220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-51G2-like family protein